SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126466104|ref|YP_001041213.1| from Staphylothermus marinus F1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126466104|ref|YP_001041213.1|
Domain Number 1 Region: 94-240
Classification Level Classification E-value
Superfamily vWA-like 0.0000000000000682
Family Integrin A (or I) domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|126466104|ref|YP_001041213.1|
Sequence length 309
Comment von Willebrand factor A [Staphylothermus marinus F1]
Sequence
MHPEMTNVMLIIIPILTLLYIYVYSRRRTLLKLLNQRDNILWHIIQASKIASIILLLLAS
TLPVTVQTIQFTVHGNPEETEIKRVMYNITALHVLLIDESKSMQYTDGTNITRFVRALNF
TYRYMNYLSPKDKLLIIGFSEYPRKICLGNITFCHPKLLELSPDKRYSDLSAALAYAYSY
VTASQYPAIIVIVSDGAYNEGGDPYDEIVSINKSGYPVLFVRIGLDKRADQLVEELTASN
IYVININQFTEKLLNKLTEDAARQMRLEAFISKKLLEVKVSKEVVYPYPTIYLLVASLVL
FLASRIEGY
Download sequence
Identical sequences A3DNU5
gi|126466104|ref|YP_001041213.1| 399550.Smar_1211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]