SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126466207|ref|YP_001041316.1| from Staphylothermus marinus F1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126466207|ref|YP_001041316.1|
Domain Number 1 Region: 42-179
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.0000000000759
Family ATP-dependent protease Lon (La), catalytic domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126466207|ref|YP_001041316.1|
Sequence length 596
Comment serine proteases-like protein [Staphylothermus marinus F1]
Sequence
MKIDKTIKIVAFMFLLLLVLSQTSIIAETTSEYLVSSVNTYLLAVTDSNVGVVVNVTLQA
YFPGDGEVDIVEKNGVIGEDTLYSIYYSLRLASLVTGIDYKSYNYKIIFPEEIDLKGTSA
TLAFTLGFIGLFKNIKYSPKIGATGVVAPNLIVGNVSGIDAKYYAALRYGLDYVIGPPQF
FRFSLRKYIYAIDVFNAYNYYSGDKILPSIQVMGKLCIKHLINAFNYSYINLKKSIDQYL
QRHNINIYSINGSTYYFLANKYYSIGDFYTAASYMFRAYINIYTSILARKAISDPKIPTL
LKEWIQHNLTKTKDIIENYETLLLNKYYNIWNFDVFLNAYIRYSQSKLYYYAGNNVTNPI
QKTEYYVLSLARMQTVNHWLKLFINKSDPDFLANINDNYDRIIDYINISLTYLKSMNYIG
NLTIKHFKSIVNSNQSNTRKILYLGYYFYTLNQNLSAIRGLFDLFISPKTIIDLNKTING
LGYLIASETGYLAPTMLTTIELVKDYLIEGEKTYDLGVLMSMNLAILVFELMITRQYMRL
SSEKTIHTQIVSSHELRYDILPAIITLVIGSFLIGYLIGKIRNKPPTLENQVWFYT
Download sequence
Identical sequences A3DP48
WP_011839602.1.69113 gi|126466207|ref|YP_001041316.1| 399550.Smar_1317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]