SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126466244|ref|YP_001041353.1| from Staphylothermus marinus F1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126466244|ref|YP_001041353.1|
Domain Number 1 Region: 156-441
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.62e-75
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000716
Further Details:      
 
Domain Number 2 Region: 6-113
Classification Level Classification E-value
Superfamily tRNA-binding arm 2.2e-22
Family Seryl-tRNA synthetase (SerRS) 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|126466244|ref|YP_001041353.1|
Sequence length 459
Comment seryl-tRNA synthetase [Staphylothermus marinus F1]
Sequence
MSWSILKLLREKPEELKEHVKKRFMDPSIVDEAYKTDLEWRRTLTYIQELRHKHNVVSRE
IPKLKGVDKEKKIKEAKQLLKELEEVEKKLKELEEKRQKLLFSLPNIVHETVPVGPDDTY
NVPIRFWGKPRVWKGFIDQFKEQTEKYGFKVEYEVIDWKPVGHADMLEKVLRLGDTFKAG
QVAGSRFYYLFNDIVFLDMALLAYAIDYLTSKGYTLVLPPYMLRHKVMMGVIDMDTFKDA
IYKIEGEDLYLIATAEHPLAALHAWEDIPEEELPLKYVGISPCFRKEAGAGNRDLKGIFR
VHQFHKVEQFVYAKPEDSWDIMEELISNAEHLFRGLGIPYRIVNIASGDLGAPAAKKYDL
EAWMPAQGRYREMVSCSNVTDWQAFRLRIRLIRRKGMVKEYLHTLNSTAIASTRTITAIL
ENFQEPDGTVIVPKVLRKYLEVFKSAPIDAIHPVKKEKN
Download sequence
Identical sequences A3DP85
399550.Smar_1354 gi|126466244|ref|YP_001041353.1| WP_011839639.1.69113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]