SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113969259|ref|YP_733052.1| from Shewanella sp. MR-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113969259|ref|YP_733052.1|
Domain Number 1 Region: 4-135
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.7e-22
Family SMI1/KNR4-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113969259|ref|YP_733052.1|
Sequence length 141
Comment hypothetical protein Shewmr4_0915 [Shewanella sp. MR-4]
Sequence
MSNYRDKFEYPESPATPEDVELLEKWLGNNLPSEYKIFLLETNGAETPIGVQEPDDSIVL
WSAREVSELTEAYCYEQYLPGLIAIGSDGGGESIVFDTTHSKSSEEWPLYRVPFADLTKE
AMVLLAVSFKDWVTNGYTLKF
Download sequence
Identical sequences gi|113969259|ref|YP_733052.1| WP_011621709.1.3791 60480.Shewmr4_0915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]