SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113971515|ref|YP_735308.1| from Shewanella sp. MR-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113971515|ref|YP_735308.1|
Domain Number 1 Region: 1-132
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 8.76e-46
Family SMI1/KNR4-like 0.00000495
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113971515|ref|YP_735308.1|
Sequence length 135
Comment hypothetical protein Shewmr4_3181 [Shewanella sp. MR-4]
Sequence
MHDIIEQLQERSETVPVPLELPTFEQLVEVEEQILIPLPRELKEYLLHASDVIYGAIEPV
TAADPYSHTYLPEVTCYAWSIGLPRDLIAICQLGDDFYCIDQDGQVHFWQNGDFTDTYWE
SFWEWVEDIWLKNKY
Download sequence
Identical sequences A0A073KXM8 A0A0P7JT03 A0A1Z4AGR1 A0A252F042 A0KT76 V1DEJ1
gi|117919209|ref|YP_868401.1| MES00005523545 60480.Shewmr4_3181 94122.Shewana3_0757 WP_011623923.1.101270 WP_011623923.1.37160 WP_011623923.1.3791 WP_011623923.1.419 WP_011623923.1.57664 WP_011623923.1.63360 WP_011623923.1.71012 WP_011623923.1.72131 WP_011623923.1.74954 WP_011623923.1.77687 gi|113971515|ref|YP_735308.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]