SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150008057|ref|YP_001302800.1| from Parabacteroides distasonis ATCC 8503

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150008057|ref|YP_001302800.1|
Domain Number 1 Region: 56-142
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 0.000000392
Family N-utilization substance G protein NusG, N-terminal domain 0.015
Further Details:      
 
Weak hits

Sequence:  gi|150008057|ref|YP_001302800.1|
Domain Number - Region: 149-180
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.018
Family Ribosomal proteins L24p and L21e 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150008057|ref|YP_001302800.1|
Sequence length 370
Comment transcriptional regulator UpxY-like protein [Parabacteroides distasonis ATCC 8503]
Sequence
MMNVLRDGRSERGTARVGKRHDLKTVRWYVLTLPTTGVARRDRISPAKSLDAELSRRKRR
GETLFEYFAPSYVEVRKVDGKMVNTKRPLLFNYVFVRSSVEEIFQMKRTLPLYNFLPRVS
SGGMTHFPYLSDDEMGNLRWVAESYSNELPVYVPDSDRLLKGDRVRITSGYFTGMEAEVV
IQPGGGHKDVMARILDCMWVPLLEVKPGEYELIELNTKGKHVYTHLDNDRLREGLHDALG
RYHASGNVSEEDTRLAREVLRSYGSLCAETDVMRCKIYSLLLSAYKLLGDEEEFTRLHDT
MRGMLPVVKAPQSRALLLVTLYGCTDSALYRQMAHEVVDPWRGESSPKKSKLSLIRRLDD
YDGWLNHEIS
Download sequence
Identical sequences A0A2J9HZT8 A6LBW4
WP_011966451.1.47855 gi|150008057|ref|YP_001302800.1| 435591.BDI_1420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]