SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113952739|ref|YP_730408.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113952739|ref|YP_730408.1|
Domain Number 1 Region: 5-313,487-548
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.48e-48
Family FAD-linked reductases, N-terminal domain 0.02
Further Details:      
 
Domain Number 2 Region: 361-463
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 5.1e-16
Family GMC oxidoreductases 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113952739|ref|YP_730408.1|
Sequence length 552
Comment glucose-methanol-choline (GMC) oxidoreductase:NAD binding site [Synechococcus sp. CC9311]
Sequence
MPLKPFEAIVIGSGATGGVATQTLAEAGIRVLVVESGPDLSAQEALGSEPINSMRRVRGL
LSGQHRNQAQHPGYWKHNPRLYADERRYPYSTPKDQPFLWTQGRQVGGRSLTWGGITLRL
SDLEFKAAERDGHGHSWPISHQDLDAHYSALERQFAIHGNRDGLAQLPDGCTIAPLSFTP
EEQQLAAALQGSADIEMIHSRGFSAHQPSPKCPWPPSSSPGSSLKTALSTGRVEVLSGHL
AERLLMNRDRSRASGVVVIDQRNGERIKLEAPLVVLCASTIASLRFLLLSERSATEGGFE
DPSASLGRHLMDHVSTCRFFQVPSRSGRESLQELDPTSQLSGAGSFFLPFGSLPPQRSGA
LPFSRGYGLWGAINRFDPPWWLKRNPDCRLGFLIGHGEVLPSHQNRVTLSETVDRWGVPI
PHISCRWGTNETAMVAHMHTLMNEAIALGGGEIQPLTDLVMMPLIEPIVGNLEAMKAGAP
PPGYYVHELGGAPMGNDENDSVVDSWNRLWRCPNVLVVDGSCWTTSAWQSPTLTMMAITR
RACQQALKPENA
Download sequence
Identical sequences Q0IAW4
64471.sync_1198 WP_011619129.1.57161 gi|113952739|ref|YP_730408.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]