SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113952808|ref|YP_729413.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113952808|ref|YP_729413.1|
Domain Number 1 Region: 1-250
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.26e-64
Family Histidine biosynthesis enzymes 0.00000343
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113952808|ref|YP_729413.1|
Sequence length 255
Comment imidazole glycerol phosphate synthase subunit hisF [Synechococcus sp. CC9311]
Sequence
MRNLRIIPRLDIKSGTLIKGVQMEGWRKVGDPILAAKRYSEYGADELLFMDVVASLYERN
TLHEIVEQVCSNVFIPVTVGGGIRKIKDVETLLSRGADKVSVNTGALLKPELINEISDRY
GSQATVLTVECLKCGEKSWEALTDNGRNRSGREVIEWVKEAENRGAGEIVLTSIDQDGRG
YGFDIDLVDIVSQAVNIPIIASGGFGKPSHIVELIKSTDVSGAAIAQALHWEKVSFSEIR
DSLRDNNVFLRDIEE
Download sequence
Identical sequences Q0IDQ9
gi|113952808|ref|YP_729413.1| WP_011618161.1.57161 64471.sync_0176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]