SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113953233|ref|YP_729663.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113953233|ref|YP_729663.1|
Domain Number 1 Region: 3-83
Classification Level Classification E-value
Superfamily Ribosomal protein S19 1.19e-34
Family Ribosomal protein S19 0.0000302
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113953233|ref|YP_729663.1|
Sequence length 91
Comment 30S ribosomal protein S19 [Synechococcus sp. CC9311]
Sequence
MGRSLKKGPFIADSLLRKVEKQNAADDKSVIKTWSRASTILPMMIGHTIAVHNGRTHVPV
FVTEQMVGHKLGEFAPTRTFKGHIKDKKGGR
Download sequence
Identical sequences A0A0H4BGE6 A0A163ZBE1 A0A164BW80 A0A2D5RCB1 A0A2D8U0C5 A0A2E9IZ40 A0A2H4P0A8 A0A2H4P0B9 A0A2H4P0C2 A0A2H4P0C6 A0A2H4P0C7 A0A2H4P0D0 A0A2H4P0E0 G4FPT7 Q05QB7 Q0ID09
64471.sync_0433 MES00005470668 WP_006854824.1.28265 WP_006854824.1.39392 WP_006854824.1.44266 WP_006854824.1.5409 WP_006854824.1.57161 WP_006854824.1.74750 WP_006854824.1.97207 gi|113953233|ref|YP_729663.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]