SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113953349|ref|YP_730888.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113953349|ref|YP_730888.1|
Domain Number 1 Region: 8-228
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.68e-53
Family D-ribulose-5-phosphate 3-epimerase 0.00000718
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113953349|ref|YP_730888.1|
Sequence length 244
Comment ribulose-phosphate 3-epimerase [Synechococcus sp. CC9311]
Sequence
MAATHRPIQIIPSVLPADWAAMGQCVKDLEDAGVDRIQFDVMDGNFVPNLTFGPELIKAC
RRYCNVPFETQLMVSQYNCETMLEEYVEATKGANGEPGVVIAHVEANTHLHRILGRIRQL
GGSPSVALNPHTPMEMVKDVLDLVDHVLVMTVNPGFGGQAYIPTMLNKISELRKNIVERN
LDVDIEVDGGIKANWTISQCCAAGANCFIAGSGMFAYPSLKEGCDDLRRVASEAQSGNVL
STPA
Download sequence
Identical sequences Q0I9I4
gi|113953349|ref|YP_730888.1| 64471.sync_1684 WP_011619602.1.57161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]