SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113953354|ref|YP_731291.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113953354|ref|YP_731291.1|
Domain Number 1 Region: 2-100
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.65e-34
Family Ribosomal protein S14 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113953354|ref|YP_731291.1|
Sequence length 100
Comment 30S ribosomal protein S14 [Synechococcus sp. CC9311]
Sequence
MAKKSMIARDVKRKKMVERFSDRRAALMAAFHAAKDPMERLEIHRKIQGLPRNSAPNRVR
NRCWATGKPRGVYRDFGLCRNQLRERAHKGELPGVVKSSW
Download sequence
Identical sequences A0A0H4BDS5 A0A2D7U507 Q0I8D1
64471.sync_2089 gi|113953354|ref|YP_731291.1| WP_011620003.1.28265 WP_011620003.1.57161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]