SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113953413|ref|YP_730544.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113953413|ref|YP_730544.1|
Domain Number 1 Region: 14-71
Classification Level Classification E-value
Superfamily Ribosomal protein S18 2.22e-25
Family Ribosomal protein S18 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113953413|ref|YP_730544.1|
Sequence length 73
Comment 30S ribosomal protein S18 [Synechococcus sp. CC9311]
Sequence
MSSSFFKKRLSPIKPGDPIDYKDVDLLKKFITERGKILPRRLTGLTAKQQRDLTNAVKRA
RIVALLPFVNPEG
Download sequence
Identical sequences A0A076H212 A0A076H8W3 A0A076HK50 A0A0H4BBA5 A0A0H5Q7I7 A0A0R2U713 A0A164AYZ2 A0A164C115 A0A182ALK7 A0A1L5YB68 A0A1Z8PII6 A0A1Z8WCY2 A0A1Z9JG18 A0A1Z9Q0F0 A0A1Z9W343 A0A2D5RA70 A0A2D6FEU7 A0A2E0AJQ8 A0A2E1IK17 A0A2E1IP53 A0A2E4LN85 A0A2E8TG93 A0A2G4G2S2 A0A2H4P3Y8 A0A2H4P3Z5 A0A2H4P400 A0A2H4P405 A0A2H4P407 A0A2H4P409 A0A2H4P410 A0A2H4P415 A0A2H4P416 A0A2H4P417 A0A2H4P418 A0A2H4P419 A0A2H4P425 A0A2H4P426 A0A2H4P428 A0A2H4P430 A0A2H4P432 A0A2H4P434 A0A2H4P437 A0A2H4P438 A0A2H4P440 A0A2H4P442 A0A2H4P444 A0A2H4P450 A0A2H4P451 A0A2H4P453 A0A2H4P454 A0A2H4P456 A0A2H4P469 A0A2H4ZNT4 A3Z6P5 A4CUF4 A5GLA3 B1X3I0 B5IJW9 G4FK63 K9P3R7 Q066Y4 Q0IAH8 Q3AJZ1 Q3AVJ4 Q7U6W1 W0GYP9
MES00000842922 gi|78212867|ref|YP_381646.1| gi|78184710|ref|YP_377145.1| gi|33865759|ref|NP_897318.1| gi|113953413|ref|YP_730544.1| 110662.Syncc9605_1337 316279.Syncc9902_1137 32051.SynWH7803_1292 64471.sync_1337 84588.SYNW1225 gi|148239628|ref|YP_001225015.1| WP_006041316.1.100374 WP_006041316.1.100798 WP_006041316.1.26789 WP_006041316.1.28265 WP_006041316.1.28472 WP_006041316.1.34419 WP_006041316.1.39392 WP_006041316.1.44266 WP_006041316.1.53145 WP_006041316.1.53453 WP_006041316.1.5409 WP_006041316.1.55822 WP_006041316.1.56957 WP_006041316.1.57161 WP_006041316.1.60914 WP_006041316.1.63644 WP_006041316.1.65281 WP_006041316.1.66731 WP_006041316.1.69047 WP_006041316.1.73772 WP_006041316.1.81689 WP_006041316.1.89092 WP_006041316.1.90151 WP_006041316.1.93620 WP_006041316.1.97207 gi|427701859|ref|YP_007045081.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]