SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113953676|ref|YP_731890.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113953676|ref|YP_731890.1|
Domain Number 1 Region: 61-236
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.33e-74
Family HD domain 0.00000168
Further Details:      
 
Domain Number 2 Region: 226-440
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.06e-58
Family RelA/SpoT domain 0.0000199
Further Details:      
 
Domain Number 3 Region: 423-495
Classification Level Classification E-value
Superfamily TGS-like 1.63e-19
Family G domain-linked domain 0.087
Further Details:      
 
Domain Number 4 Region: 699-774
Classification Level Classification E-value
Superfamily ACT-like 0.000000000396
Family AF1403 N-terminal domain-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113953676|ref|YP_731890.1|
Sequence length 778
Comment RelA/SpoT family protein [Synechococcus sp. CC9311]
Sequence
MLNATSAPDPSQTQSGSTSAACGLTALRERPLRLPDGYDIELPDWLKQCLTHVPPGIGHS
CPTDPEALLAAAFDFAFQLHEGQFRASGDPYIVHPVAVADLLRDIGASASVIAAGFLHDV
VEDTDVTPDQIESHFGPEVRELVEGVTKLGGLHFTNRTEAQAENLRKMFLAMASDIRVVL
VKLADRLHNMRTIGALKEEKQQRIARETREIYAPLANRLGIGRFKWELEDLSFKLLEPEA
FREMQQEVSTKRSEREDRLSVTVQLLCDRLAAVGLDSCEVSGRPKHLYGIWTKMQRQQKE
FHEIYDVAALRILTPNVESCYRALAVVHDTFRPIPGRFKDYIGLPKPNGYQSLHTAVIGR
HRPIEVQIRTWDMHQVSEFGIAAHWKYKEGGSPATGGDTERFNWLRQLVDWQQEGAADDH
NDYLASIKEDLFDEEVFVFTPKGDVVGLRKGSTAVDFAFRIHSEVGNHCHGVRINDRLLP
LSTPLQNGDFIDILTSKNAHPSLDWLNFVATPTARNRIRQWYKRSHRDETIDRGKELLER
ELGRSGFDALLGSEAMLKVAERCNLQTTEDLLAGLGFGALTLHQVLNRLREEIRLQTAAV
EAPLSNEDVAKQLVKQSEQPSNRDVPSVGAAPILGVEGLDHRLGGCCSPLPGEPILGAVA
LGNHGITIHRQDCANLEAIPTERRLPVRWNPSLQEVGSRFPAHLRIEVIDRVGILKDILM
RLSDGSINVSDAQVRTAYGKPARIDLMVELGSAAQLQRTMNQIRSMADVIDIARTGQS
Download sequence
Identical sequences Q0I6N2
gi|113953676|ref|YP_731890.1| 64471.sync_2702 WP_011620594.1.57161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]