SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113953825|ref|YP_730348.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113953825|ref|YP_730348.1|
Domain Number 1 Region: 3-242,271-382
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.67e-24
Family FAD/NAD-linked reductases, N-terminal and central domains 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113953825|ref|YP_730348.1|
Sequence length 459
Comment tRNA (uracil-5-)-methyltransferase Gid [Synechococcus sp. CC9311]
Sequence
MSEQSSVVVIGAGLAGTEAAWQVAKAGVPVTLWEMRPFKRSPAHHSSEFAELVCSNSFGA
LSSDRAAGLLQEELRRLGSLVIQTADHHSVPAGGALAVDRGRYSAALTSALDDHPLVTIR
REEQLTLPDPDQIAVLATGPLTSEALADDLRAFTGREDCHFFDAASPIVEGESIDMTKAF
RASRYDKGDADYINCPMDQDQFLAFRAALLDAEQAELKDFDQNSATFFEGCLPIEELARR
GEDTMRYGPLKPIGLWDPRWGDVNDRDVRRAKRAYAVVQLRQEDKDGRLWNLVGFQTNLK
WGEQKRVLRLIPGLEQADFVRFGVMHRNTFLEAPELLEPTLQFRRRPHLLAAGQITGTEG
YAAAVAGGWLAGTNAARLVHGHDPMQLPHTTMIGALTHFISEAPSGKFQPMPPNFGLMPQ
LQECIREKRARYGAYRDRALADLQRTIDESQVDNVVCTA
Download sequence
Identical sequences Q0IB24
64471.sync_1138 gi|113953825|ref|YP_730348.1| WP_011619069.1.57161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]