SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113953852|ref|YP_731930.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113953852|ref|YP_731930.1|
Domain Number 1 Region: 72-349
Classification Level Classification E-value
Superfamily PLP-binding barrel 4.67e-66
Family Alanine racemase-like, N-terminal domain 0.0016
Further Details:      
 
Domain Number 2 Region: 467-568
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 0.00000942
Family Eukaryotic ODC-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113953852|ref|YP_731930.1|
Sequence length 644
Comment arginine decarboxylase [Synechococcus sp. CC9311]
Sequence
MVLADSITWTGSDSAQLYGLERWGDPYFSINPRGHVSVQPRGDRGGSLDLMELVAGLQDR
SLGLPLLIRFDDILEDRLERLHAAFERAVTRYDYEGRYQGVFPVKCNQQRHVVEELVTCG
RRWHFGLEAGSKAELLIALSLMDDPEALLICNGYKDQRYIETAILARRLGRRPVVVIEQP
DEVQRIIDASQELGAAPLIGIRARLSSRSTGRWGSSVGDKAKFGLPAPEIIGAVEALRDA
NLLSELRLLHFHVGSQINDIVVVKDALQEASRLYVELHALGAPMGYLDVGGGLGIDYDGS
RTATAASTNYSLQNYANDVVATVKEGCEPNNVPVPTLISESGRAIASHFSVLVFNVLGSG
GLQQPTPPIERDEPLIVRNLRETLQGIEALPTETPVDPSRLQEAWNDALKFKEDALAAFR
LGYLSLKERSMAEQLTWACARALLDRLHDVAKLPDDLKTLPAVLAETYYANLSIFRSAPD
TWAIQQLFPVMPLHRLNEQPTRLGHFADLTCDSDGKLNRFINDGQNKPLLELHQLKLNEP
YLIGMFLGGAYQEVMGNLHNLFGSTDAAHIRLAPGGDYQVDHVVRGDTNADVLEMMEHDP
DQLLERLRMASEKAISSGQLRISEARRLMDHLEISLHQSTYLQG
Download sequence
Identical sequences Q0I6J2
gi|113953852|ref|YP_731930.1| 64471.sync_2742 WP_011620634.1.57161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]