SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113953980|ref|YP_730617.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113953980|ref|YP_730617.1|
Domain Number 1 Region: 4-353
Classification Level Classification E-value
Superfamily Tryptophan synthase beta subunit-like PLP-dependent enzymes 6.81e-104
Family Tryptophan synthase beta subunit-like PLP-dependent enzymes 0.0000000223
Further Details:      
 
Domain Number 2 Region: 326-411
Classification Level Classification E-value
Superfamily ACT-like 8.4e-27
Family Allosteric threonine deaminase C-terminal domain 0.00043
Further Details:      
 
Domain Number 3 Region: 408-506
Classification Level Classification E-value
Superfamily ACT-like 9.84e-25
Family Allosteric threonine deaminase C-terminal domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113953980|ref|YP_730617.1|
Sequence length 508
Comment threonine dehydratase [Synechococcus sp. CC9311]
Sequence
MDHYLPRILRARVYDVARETPLELANNLSRRLNNSVLLKREDLQPVFSFKLRGAYNRMAQ
LSEAELKLGVIASSAGNHAQGVALSASHLGCRAVIVMPVTTPGVKVDAVRQLGAEVVLHG
ETYDEAYAEARSRSEAEQLCFIHPFDDPEVIAGQGTVGMEILRQCHQPPDAIYVAVGGGG
LIGGIAVYVKSLWPDVQIIGVEPHDAAAMTLSLEAGERIRLPQVGLFADGVAVREVGEHT
FELAQKYVDDIVTVSTDEICAAIKDVFEDTRSILEPAGALAIAGLKADVSRRSLQNQNLV
AVACGANINFARLRFVAERAELGEEREAMLAVEIPERPGSLRSLCELLADRSLTEFSYRM
GAGDQAHIFMGVQVSGPDDRATLIGHLKTHGYACLDLSDDELSKVHLRHMVGGRLPESSI
ASNVQELLYRFEFPERPGALMRFVTALHRDWSISIFHYRNHGADVGRIVVGVLVSTDDLK
EWQSFLRELGYSSWEETSNPAYQLFLGG
Download sequence
Identical sequences Q0IAA5
gi|113953980|ref|YP_730617.1| WP_011619334.1.57161 64471.sync_1411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]