SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113953997|ref|YP_729464.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113953997|ref|YP_729464.1|
Domain Number 1 Region: 194-431
Classification Level Classification E-value
Superfamily Poly A polymerase C-terminal region-like 5.1e-25
Family Poly A polymerase C-terminal region-like 0.0026
Further Details:      
 
Domain Number 2 Region: 48-185
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.05e-23
Family Poly A polymerase head domain-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113953997|ref|YP_729464.1|
Sequence length 434
Comment poly(A) polymerase [Synechococcus sp. CC9311]
Sequence
MRVWGPKFSTRAWHRSSLLEAEGVERPGLPPQLLPALQALASEVGVSRLALVGGAVRDAL
LHDEHCDPWRELPDLDLVMEGSASELAAALQRHYGDERVQEVRVHGAYGTAELSFDGVLL
DLAGARQDHYPAPGENPVVESGSLERDLERRDFTVNAMALELSLSGDREPLLLDPHGGQA
HLERRELAFLHASSVADDPTRVIRAARYGARLGFVLTPSSQDQLRTTLKRWPWSWRHGQS
TEHVPPALGTRLRMELELLFENEPWLKALELLQQWGALALLDPLLSSNATLIRRLRWAMR
LKVPLILALVAAATDPCSLGQRLQLPLRQQRLLEESMSLTNWLHSEVLPQAWVGWSAVQW
TEALETRAWSPESVVLTVAMGVPCWRPMLRWWGRWRKIRSPLSAKDLIASGIPAGPGLGL
ALHQARVKALDSMR
Download sequence
Identical sequences Q0IDK8
64471.sync_0228 WP_011618212.1.57161 gi|113953997|ref|YP_729464.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]