SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113954074|ref|YP_731345.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113954074|ref|YP_731345.1|
Domain Number 1 Region: 341-535
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 8.16e-48
Family Ppx associated domain 0.0013
Further Details:      
 
Domain Number 2 Region: 147-328
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.02e-39
Family Ppx/GppA phosphatase 0.0012
Further Details:      
 
Domain Number 3 Region: 19-142
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.89e-34
Family Ppx/GppA phosphatase 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113954074|ref|YP_731345.1|
Sequence length 536
Comment exopolyphosphatase [Synechococcus sp. CC9311]
Sequence
MLQVTAGPSFQNGRTLRKIAAIDIGTNSTHLLVASVDPELRTFSIELAEKSTTRLGERDP
ETGNLSEAAIERGLKALRRFRDLALSHQVEQIVTAATSAVREAPNGRDFLQEIQDQLDLE
VDLVSGPEEARLIYLGVLSGMPFGDCPHLVLDIGGGSTELILADGRDARALTSTRVGAVR
LQRDFVTDDPMPPQRRTFLQAFIQGSLEPAVNKVLRRITPEETPVMVATSGTAMAIGAIA
ASEEDRPPLKLHGYRVSKQRLDRVVDRLVMMTPDQRKGLAPINDRRAEIIVPGALILQTS
MQMLRVKELVLSERALREGLIVDWMLRHGLLEDRFSFQSSIRQRTVIHQVQRFAVNQQRA
ERVASHALTLYDNTKDHLHRDDGSGRDLLWAAAMLHACGQHINLSAYHKHSWYLIRHGEL
LGYSEAEHLMVAAIARYHRRSLPKKRHESWQALQTRDNRRTVSDMALLLRLAVALDRRPE
PVVKSLLVKVKNEDLVLELVGEKADQDFSLEQWSLESCAPILREVAGLNLTLKVQE
Download sequence
Identical sequences Q0I877
WP_011620057.1.57161 64471.sync_2143 gi|113954074|ref|YP_731345.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]