SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113954188|ref|YP_731037.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113954188|ref|YP_731037.1|
Domain Number 1 Region: 9-194,338-374
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.7e-19
Family FAD-linked reductases, N-terminal domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113954188|ref|YP_731037.1|
Sequence length 375
Comment hypothetical protein sync_1833 [Synechococcus sp. CC9311]
Sequence
MGDSQHLDVDLAVIGAGLGGTGLAAALRQRGFDGSILLLEAGRGPGGRAATRRRRDDLLW
RLDHGAPCFSFSQPPQGSLAELWNPLLDQGIVQPDLGLVVGLSETGCLVDPPQHPLLQGP
RFRGVPTMSSVPEAFLRAAGSKTQGAFGERISSLRRENGWWCFSGRRRARSLVVTGNLLA
HPRSLAMLGWPDVPLRSAVPLYVDPLLDAALAQISEMDASVRWNLMLELPRCTDHLPRQI
WLTSDAQERFGIERIVLHRQRDRRLGLVAHGKDDGSPITPASQPGLLLEQESRQRKALTQ
LLRPWPELAQALPLARSLGVMRWGASQPLDYPLPKSLQWCELSSVGFCGDWIAGPGFGMA
EGALQSAADLADQLV
Download sequence
Identical sequences Q0I935
gi|113954188|ref|YP_731037.1| 64471.sync_1833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]