SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113954246|ref|YP_731406.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113954246|ref|YP_731406.1|
Domain Number 1 Region: 171-489
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.81e-112
Family Leucine aminopeptidase, C-terminal domain 0.000000261
Further Details:      
 
Domain Number 2 Region: 1-161
Classification Level Classification E-value
Superfamily Macro domain-like 2.65e-21
Family Leucine aminopeptidase (Aminopeptidase A), N-terminal domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113954246|ref|YP_731406.1|
Sequence length 496
Comment leucyl aminopeptidase [Synechococcus sp. CC9311]
Sequence
MQISLSSAQPQAWSGTVLALGIAEGDPNGWIPAMEERFSISLGDWLEQRKFQGKNGESAS
LQLLNPNCESLVLIGLGPLEALDVNSFRQAGAAAARASKNQTGSIGLLLPWNAVDPAEAV
TVAAQAVRLALYSDQRFRSKPEPSIHPERLELLGPLPNTLSSALEAVHPICAGVELAREL
VAAPPNSVTPSALAESAAQMAHEHGLDLKVLERSDCEARGMGSFLSVCQGSDMDPKFIHL
TYRPSGPATKRVVLVGKGLTFDSGGYNLKVGAAQIDMMKFDMGGSAAVLGAMRSIAELRP
QGVEVHMLVASCENMINGSAVHPGDIVTASNGTTIEINNTDAEGRLTLADALVYASELEP
DAIVDLATLTGACVIALGDEIAGLWTGDDSLANSLEGAAKDAGEGLWRMPMHQAYRKGLK
SLLADLKNTGPRPGGSITAALFLKEFVRSSIPWAHIDIAGTVWSDKGRGMDPAGATGYGV
RTLVSWVCAQTQQAEN
Download sequence
Identical sequences Q0I816
64471.sync_2208 WP_011620118.1.57161 gi|113954246|ref|YP_731406.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]