SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113954345|ref|YP_731568.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113954345|ref|YP_731568.1|
Domain Number 1 Region: 8-146
Classification Level Classification E-value
Superfamily Transcription factor NusA, N-terminal domain 5.89e-27
Family Transcription factor NusA, N-terminal domain 0.00074
Further Details:      
 
Domain Number 2 Region: 229-310
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 1.37e-23
Family Prokaryotic type KH domain (KH-domain type II) 0.00017
Further Details:      
 
Domain Number 3 Region: 312-376
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 4.32e-16
Family Prokaryotic type KH domain (KH-domain type II) 0.00017
Further Details:      
 
Domain Number 4 Region: 152-225
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000146
Family Cold shock DNA-binding domain-like 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113954345|ref|YP_731568.1|
Sequence length 501
Comment transcription elongation factor NusA [Synechococcus sp. CC9311]
Sequence
MALVLLPGLSNLIEDISEEKKLAPQVVEAALREALLKGYERYRRTLYLGISEDPFDEEYF
SNFDVALDLDEEGYRVLASKIIVDEVESEDHQIALAEVMQVAEDAQAGDTVVLDVTPEKE
DFGRMAAATTKQVLAQKLRDQQRRMIQEEFADLEDPVLTARVIRFERQSIIMAVSSGLGR
PEVEAELPRRDQLPNDNYRANATFKVFLKEVSEVPRRGPQLFVSRANAGLVVYLFENEVP
EIQEGSVRIVAVAREANPPSRAVGPRTKVAVDSIEREVDPVGACIGARGSRIQQVVNELR
GEKIDVIRWSQDPSQYIANSLSPARVEVVRLVDPEGQHAHVLVPPDQLSLAIGREGQNVR
LAARLTGWKIDIKNSTEYDQTAEDAVVSELISQREEEEALQREAEERLAIEQAARAEEDA
RLRELYPLPEDEEGYTEDGEYYEDAEAAGEEPVAEAVEESVETADTELQAEDQATEHTEQ
QEDELDSEDAPNTSDVEEGAR
Download sequence
Identical sequences Q0I7K4
64471.sync_2371 gi|113954345|ref|YP_731568.1| WP_011620278.1.57161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]