SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113954430|ref|YP_731114.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113954430|ref|YP_731114.1|
Domain Number 1 Region: 6-250
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.51e-86
Family Tryptophan biosynthesis enzymes 0.00000231
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113954430|ref|YP_731114.1|
Sequence length 268
Comment tryptophan synthase subunit alpha [Synechococcus sp. CC9311]
Sequence
MTDQLSRIEAVFSRTAQEQRMALMPFLMAGDPDLSATAEVLLSLQANGADIVELGIPYTD
PLADGPVIQAAAFRALEQKTTPAKVIEMLAGLKDQLSMPVILFTYTNPLLNRGPERFFAE
AAAAGAAGLVVPDLPLEEAERLSPLAATFGLDLVLLVAPTTPQNRMQRIAESSRGFTYLV
SVTGVTGERVKLQDRVASLVSDLKACNSGPVAVGFGISGPEQVLQVKQWGADGAIVGSAL
VKRIAAAAPGKAALEAGEFCRQLRDAAG
Download sequence
Identical sequences Q0I8V8
64471.sync_1910 gi|113954430|ref|YP_731114.1| WP_011619827.1.57161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]