SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113954751|ref|YP_730696.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113954751|ref|YP_730696.1|
Domain Number 1 Region: 374-549
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.04e-40
Family Pyruvate oxidase and decarboxylase PP module 0.0000608
Further Details:      
 
Domain Number 2 Region: 5-178
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.17e-39
Family Pyruvate oxidase and decarboxylase Pyr module 0.00000962
Further Details:      
 
Domain Number 3 Region: 165-343
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 8.92e-25
Family Pyruvate oxidase and decarboxylase, middle domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113954751|ref|YP_730696.1|
Sequence length 568
Comment indolepyruvate decarboxylase [Synechococcus sp. CC9311]
Sequence
MTPSVVTYALDRLADLGIGHVFGVPGDYSFPINDAVEVHPRLRWVPSANELNAAYAADGY
ARRRGAAIVCTTYGVGELSALNGLMGAMAERLPVFHLVGTPSLRIVRQGLICHHTLGDRN
YDRFEAISASASCVSARLTPENAVIELERVIDKALEQSRPAYLTFPMDLALMPITGTPIQ
GSPLGVIDQHDSVSAELEAVLDLLESRIASASRPVVLPTITLKRFGLVNAFEEFLKASGL
AYATTPMDKALLSEQHPAFLGMYNGGRSTPAALQSVVEEADLVVDIGGLVLEDLNTGLWS
GSLDPNRIVALHADWVQAGHQVFTSVSISDVLAGLTRRFQTSSKRLSYWGEHRPVRPAPM
LPLLGEPDQPTDSASFYPRLQQFLRPNDLLLSDTGTCLLKLNAIRLPDGVTMESQTLWGS
IGWGTPAALGCALAEPERRVVLVTGDGAHQLTVQEIGVMGFTGVNPVVIVLNNGLHGIEA
LISETGHAYNDLPPWHYANIPAALGCKDWWSGRAATVAELEQALAAISAHQGAAYLEVVI
PAEESQPLAEEVIEIFHQTTTPKSALTD
Download sequence
Identical sequences Q0IA26
WP_011619413.1.57161 gi|113954751|ref|YP_730696.1| 64471.sync_1491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]