SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113954804|ref|YP_730603.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113954804|ref|YP_730603.1|
Domain Number 1 Region: 4-67
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00000000000000193
Family 7-Fe ferredoxin 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113954804|ref|YP_730603.1|
Sequence length 74
Comment (Fe-S)-binding protein [Synechococcus sp. CC9311]
Sequence
MAHTIVTDICEGVADCVDACPVACIKPGSGANKKGTDFYWIDFDTCIDCGICLQVCPVAN
AIVPEERADLQSGG
Download sequence
Identical sequences Q0IAB9
gi|113954804|ref|YP_730603.1| 64471.sync_1397 WP_011619321.1.57161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]