SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113954856|ref|YP_729609.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113954856|ref|YP_729609.1|
Domain Number 1 Region: 3-188
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.95e-49
Family Phosphate binding protein-like 0.00047
Further Details:      
 
Domain Number 2 Region: 183-275
Classification Level Classification E-value
Superfamily ACT-like 2.57e-21
Family Phenylalanine metabolism regulatory domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113954856|ref|YP_729609.1|
Sequence length 279
Comment prephenate dehydratase [Synechococcus sp. CC9311]
Sequence
MPMRVAFLGPEGTYGERAARSLMRLEAIENPELVACLGLRSVVEHVADGRCESAVVPVEN
SVEGGVTAILDALWSYSNLRIRRAVVLPIRHALLSSGTLDGISEVLSHPQALAQCSGWLA
RHLPQAVQLPASSTAEAARMVRGSHFRAAIADRSLAGQQGLQELAYPVNDVAGNRTRFLL
LQNGEVSREGDVASLALSLHQNTPGALIEALEVIAQLGLNMSRIESRPSKRELGEYVFFV
DVELPGKETSELLEQLTTSLQPLCEHLLHFGAYPSSVLE
Download sequence
Identical sequences Q0ID63
64471.sync_0377 WP_011618349.1.57161 gi|113954856|ref|YP_729609.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]