SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113954891|ref|YP_731185.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113954891|ref|YP_731185.1|
Domain Number 1 Region: 16-250
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.57e-42
Family LplA-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113954891|ref|YP_731185.1|
Sequence length 278
Comment biotin/lipoate A/B protein ligase family protein [Synechococcus sp. CC9311]
Sequence
MSIPASCRSEFETLGRLIPAIAGQGPEHMAFDALLLKQCQSTSNPGPVLRFYHWEGSWLS
LGRHQTPRSNHWLDLLRNRRLNMVRRPSGGGAVLHGGGLTYALIWPDPPRQRREAYRRVN
AWISSGLARLGLELHPGDDPALAGSQHCFASATAADLVDPSGQKRIGSAQFWQKGHLLQH
GEIPLAPSEQLWKEVFGTAPPCWQPSAPSAASVEIALTEAISEIWPGLRWGVTPMSGLEQ
QLVAERASNYQVNDSEVSSNNPEARMDITAWRRGRPKG
Download sequence
Identical sequences Q0I8N7
gi|113954891|ref|YP_731185.1| 64471.sync_1982 WP_011619897.1.57161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]