SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113954916|ref|YP_729995.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113954916|ref|YP_729995.1|
Domain Number 1 Region: 8-164
Classification Level Classification E-value
Superfamily IpsF-like 1.57e-61
Family IpsF-like 0.00000672
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113954916|ref|YP_729995.1|
Sequence length 166
Comment 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Synechococcus sp. CC9311]
Sequence
MTSSVPSLRIGNGYDVHRLVPDRPLILGGQLLEHPAGLGLDGHSDADVLVHAIMDALLGA
LSLGDIGKYFPPSDPQWKGADSLVLLEQVVALVKARGWGVVNVDAVLIAERPKLKPHIEA
MRSAIALRIGVAPDQVGVKATTNEQLGPEGREEGISCQAVALLQAL
Download sequence
Identical sequences Q0IC27
WP_011618722.1.57161 gi|113954916|ref|YP_729995.1| 64471.sync_0781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]