SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113954933|ref|YP_731793.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113954933|ref|YP_731793.1|
Domain Number 1 Region: 137-383
Classification Level Classification E-value
Superfamily Poly A polymerase C-terminal region-like 2.75e-40
Family Poly A polymerase C-terminal region-like 0.0025
Further Details:      
 
Domain Number 2 Region: 18-134
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 7.85e-20
Family Poly A polymerase head domain-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113954933|ref|YP_731793.1|
Sequence length 386
Comment poly(A) polymerase [Synechococcus sp. CC9311]
Sequence
MARQLMTRLQPQRWPIPLDRLPVGTVLVGGAVRDGLLNRLPEHPDLDMVVPADALGQVRK
LSQEFGGSCVVLDRDRDMARLVLGRWTIDLARQEGDALTADLMRRDYRINAIALTLTTEP
KLVDPSGGIPDLRDQRITAIHEQNLLDDPLRLLRAIRLSSELSMTIDQGTLEMIARHRHQ
LPKVAPERIQAELLKLVQANNADQAIHLLHSLKLIAPWSSNQPQKTFNARALTAEEQQLA
LPLARLTQLLSDQGVNDLRFSRKQIQRCLRLRAWWKRDQQQSASTLSERERLKLHEELEE
DLPAFTLAWPVERQNEWLRRWRDQDDMLFHPCTPLNGRTLQAELGLRPGPRLGELIQHLC
LERAFGRIRSQDEAIQCARAWMNKPL
Download sequence
Identical sequences Q0I6X9
gi|113954933|ref|YP_731793.1| WP_011620497.1.57161 64471.sync_2605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]