SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113954952|ref|YP_731454.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113954952|ref|YP_731454.1|
Domain Number 1 Region: 99-282
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 5.2e-56
Family Formate/glycerate dehydrogenases, NAD-domain 0.0000124
Further Details:      
 
Domain Number 2 Region: 2-125
Classification Level Classification E-value
Superfamily Formate/glycerate dehydrogenase catalytic domain-like 3.97e-38
Family Formate/glycerate dehydrogenases, substrate-binding domain 0.00021
Further Details:      
 
Domain Number 3 Region: 319-450
Classification Level Classification E-value
Superfamily Serine metabolism enzymes domain 4.18e-33
Family SerA intervening domain-like 0.0024
Further Details:      
 
Domain Number 4 Region: 446-523
Classification Level Classification E-value
Superfamily ACT-like 2.62e-16
Family Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113954952|ref|YP_731454.1|
Sequence length 528
Comment D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CC9311]
Sequence
MTKVLVSDPIDQAGLDILGQVAQVDERIGLSSEELKSIIGDYDALMIRSGTQVTADVIEA
ADRLRIIGRAGVGVDNVDVPAATQRGVLVVNSPEGNTIAAAEHALAMLLSVSRHVPQAHG
SMRSGAWDRKKYVGNELYKKLLGVVGLGKIGSHVARVAKAMGMEVIAFDPFISAERAQQM
QVRLTTLEALFQQADYITLHIPRTPDTENLVNAELLRTMKSTARIVNCARGGIVDEPAIA
EAIESGVIAGAGLDVFASEPLAQDSPLRAVERGLVLTPHLGASTEEAQENVAVDVAEQIR
DVLLGLPARSAVNIPGLSAEIMERLKPHLQLAETLGLLVSQLSGGQIQELEVRLQGEFAS
HPSQPLVVAALKGLLSTALGDRINYVNASLEAKGRGIHVLEIKDDASRDFAGGSLQLTTR
GGQGGHSVTGAVFADGDLRVTSIDEFPVNVPPSRHMLFTRHRDMPGIIGHLGSLLGEHNV
NIASMQVGRRIVRGDAVMVLSIDDPIPPALLTTIHGINGIQEAHPVTL
Download sequence
Identical sequences Q0I7W8
gi|113954952|ref|YP_731454.1| WP_011620166.1.57161 64471.sync_2256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]