SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113954961|ref|YP_730546.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113954961|ref|YP_730546.1|
Domain Number 1 Region: 220-403
Classification Level Classification E-value
Superfamily PheT/TilS domain 7.85e-52
Family B3/B4 domain of PheRS, PheT 0.0000367
Further Details:      
 
Domain Number 2 Region: 36-197
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6e-42
Family Myf domain 0.0029
Further Details:      
 
Domain Number 3 Region: 490-705
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 8.95e-36
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00011
Further Details:      
 
Domain Number 4 Region: 717-815
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.1e-28
Family Anticodon-binding domain of PheRS 0.00053
Further Details:      
 
Domain Number 5 Region: 442-497
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000000192
Family Domains B1 and B5 of PheRS-beta, PheT 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113954961|ref|YP_730546.1|
Sequence length 816
Comment phenylalanyl-tRNA synthetase subunit beta [Synechococcus sp. CC9311]
Sequence
MRVSLSWLQDLVQVTEAADQLGERLSMAGFEVEEIDDLSRLAQGVVVGHVLKRDKHPNAD
KLSVCVVDIGAEETVQIVCGASNVRAGIHVPVATIGAVLPAVNLTIKAGELRGVASQGMI
CSLAELGQATDVDGIAVLDDLLESLPAPGTAVASCLGLDDTVLDLAITANRPDGLSMTGI
AREVAALTGAPLHLPQPVAPQSVTDLNPSEEHAAAMKEGGVYALTEVSGLDGGQVAPSWV
QQRLLRAGVKPVNAIVDITNLVMLEQGQPLHAFDLDALERLCGSDLTPSDFGLRQGRAKE
SFTGLDGRTIELDERVQLVTCRDRPVAIAGVIGSAESGVTETTRKILLESALFTPASIRS
SSRATGLRTDASSRYEKGLPRQITLPAAGRALELMEQLLGGMAGLSWQCCSDEGPEPLVT
LRRHALHQLLGPLVAEDGEATDVSDQQVEECLSALGCHLNSSEEGWTVLVPPSRRMDLLR
EVDLIEEVARLVGFDSFGAHLPDPLAPGGLTDRQQAERRLRRRLCSAGLQEITCLSLTGA
DADDPNRIPISNPLLAETSHLRTALWQEHLQICQRNLQASQPGCWVFEIGHVFHPLDREI
VQSARLGGVICGERRVSRWATSGKALVPDYFMARGALATVFNSLGLETQDRPLADDPRLH
PGRAAAVVVEGRTLGCFGQLHPMLCAQYELPDATYLFDLDLQRLLEAVTRRNRWVPSFKA
FSTLPAMERDLAMLVPKTLPSADLMQAIRKAGKPLLESVELIDRFEGGQLPDDQCSQAFR
LRYRGKDSTLTDEQLQPVQDKVRQALVKQFKVELRS
Download sequence
Identical sequences Q0IAH6
gi|113954961|ref|YP_730546.1| WP_011619265.1.57161 64471.sync_1339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]