SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113955090|ref|YP_729987.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113955090|ref|YP_729987.1|
Domain Number 1 Region: 22-218
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.22e-43
Family G proteins 0.00022
Further Details:      
 
Domain Number 2 Region: 195-314
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 1.11e-35
Family Prokaryotic type KH domain (KH-domain type II) 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113955090|ref|YP_729987.1|
Sequence length 317
Comment GTP-binding protein Era [Synechococcus sp. CC9311]
Sequence
MVESLSGSFTSDKSKEFRSGFVALIGRPNVGKSTLVNQLIGDKIAITSPVAQTTRNRLRA
ILTTDEAQLILVDTPGIHKPHHLLGERLVRTARSAIGEVDQVLLLLEGCEAPGRGDAFIV
QLLRQQSLPVQVLLNKWDLVPLEQKDAADAAYRELLSETDWPVHRCSALSGDGCPELVKA
ISSLMPEGPQLYPSDMVSDQPERLLMGELIREQVLLNTREEVPHSVAVSIDRIEEIPAKG
KGNGRTAVLATVLVERKSQKGILIGKGGAMLKTIGQGARLQMQTLIDGPVYLELFVKVVP
DWRSKPARLAELGYVGD
Download sequence
Identical sequences Q0IC35
64471.sync_0773 gi|113955090|ref|YP_729987.1| WP_011618714.1.57161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]