SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113955371|ref|YP_730489.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113955371|ref|YP_730489.1|
Domain Number 1 Region: 367-504
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.0000000022
Family HD domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113955371|ref|YP_730489.1|
Sequence length 719
Comment glycyl-tRNA synthetase subunit beta [Synechococcus sp. CC9311]
Sequence
MSSTFLLEIGTEELPAEFVHSALKQLQQMVVSDLKHLRLSHGQVRVSGTPRRLAVVVESL
IDRQPDLEEERKGPPVKQALVDGIPGPAALGFAKRCGVDPAELQSRDTSKGPCLFARVCT
PGDATTTLLIDRIPAWINGLQGRRFMRWGDGDQRFSRPVRWLVSLYGSELIPVTLSAATP
PVQSGRLSRSHRLRDSTVEIQHADGYCDALAKAGVMVDRSQREHLIRSALETEAQACSAS
VDCPESLFEELVDLVEAPRVLSGEIADCYLDLPPEVIVTVMQSHQRYVPLKRENAHHDPL
ALQARDALLSRFLLVSNGLDSADATIVRGNERVLGARLADAEFFLNVDRKSASEARRDAL
DRVTFAKGLGSLRDRCDRMSWMTERLIDSLSITSEIAIHAKRAAHFCKHDLVSQMVGEFP
ELQGLIGGKYLLEEGEDRQVALAVAEHYQPRGAGDALPSSDAGALLALSERLELLLSIYA
KGDRPSGSSDPYALRRAGNGIVQILWDRGWRLSLQSLLSNAARYWAELFPSFAVQPEVLV
ADLSLLLRQRMVSQFEEDGFPADLVQAVAGEAVGDARLLSDPVDARERLALLHQLRRDER
LQAVQAVVQRAAKLAEKGDLGSDQLTPSGVVQPDLFESASEASLLQSLDDLSPLAQSGNY
IQLAEGLQDAAKALEAFFDGPNSVMVMTDNLDVRRNRLNLLGVLKNQASVLAQFDCIQS
Download sequence
Identical sequences Q0IAN3
64471.sync_1281 WP_011619209.1.57161 gi|113955371|ref|YP_730489.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]