SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113955421|ref|YP_729363.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113955421|ref|YP_729363.1|
Domain Number 1 Region: 8-199,300-387
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.04e-77
Family Bacterial dinuclear zinc exopeptidases 0.0000387
Further Details:      
 
Domain Number 2 Region: 188-293
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 7.59e-28
Family Bacterial exopeptidase dimerisation domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113955421|ref|YP_729363.1|
Sequence length 391
Comment peptidase, M20D family protein [Synechococcus sp. CC9311]
Sequence
MTTTTPPLKQRLEAILPDLIELRRHLHAHPELSGEEHQTAALISGELRQCGWRVREGVGR
TGVMAELGPQSGPQLGLRVDMDALPVEERTGLPYASLRQGVMHACGHDLHSCIGLGVARL
LAQEASLPVGMRLLFQPAEELAQGARWMRADGATDGLNALFGVHVFPTLPVGTIGLRSGS
LTAAAGELEIEVIGEGGHGARPHQALDAIWIAARVVTGLQEAISRRLDALNPVVVSFGKI
EGGKAFNVIADRVTLLGTVRCLCADLHERLPAWIEETVQGICGSFGATARVRYRCIAPPV
RNDPALTALLERSAVEQLGADQVQRLDQPSLGAEDFAELLQDVPGSMFRLGVAGPDGCAA
LHNGHFNPEEGALGVGVQVLTAAMLAWRPTP
Download sequence
Identical sequences Q0IDV9
WP_011618112.1.57161 64471.sync_0126 gi|113955421|ref|YP_729363.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]