SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113953772|ref|YP_729309.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113953772|ref|YP_729309.1|
Domain Number 1 Region: 17-238
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 9.16e-52
Family PP-loop ATPase 0.00062
Further Details:      
 
Domain Number 2 Region: 246-297
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.00000144
Family MesJ substrate recognition domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113953772|ref|YP_729309.1|
Sequence length 331
Comment MesJ-like protein [Synechococcus sp. CC9311]
Sequence
MAASKSWLPWHDTLHRQLLRQPNLLPDGETLLIALSGGQDSMALLGLLLGLQHLHHWHFQ
LWHGDHGWHDQSAATASELKEWCQGQELDLQISRNTRDHTGTEASARSWRYQELAALSQQ
FCCRTVLTAHTASDRAETLLLQLARGTDLAGLGSLRPIRPLQNNDPNGTRLVRPLLTFSR
DDTTQICQDLQLPVWLDPSNANPAFSRNRIRNDVLPVLEELHPGCSQRIAQLSERVSQVE
DSQRTLATLALEQLRYERGLHRKALKVLPDATRRLLLHHWLQQQGVRTLSASQLDTLSVA
IGPGRPPGSRSLAEHKTLQWTRDSVQLVSQP
Download sequence
Identical sequences Q0IE13
gi|113953772|ref|YP_729309.1| 64471.sync_0071 WP_011618060.1.57161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]