SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113953978|ref|YP_729313.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113953978|ref|YP_729313.1|
Domain Number 1 Region: 4-245
Classification Level Classification E-value
Superfamily Carbamate kinase-like 2.09e-70
Family PyrH-like 0.0000248
Further Details:      
 
Domain Number 2 Region: 345-422
Classification Level Classification E-value
Superfamily ACT-like 3.44e-19
Family Aspartokinase allosteric domain-like 0.012
Further Details:      
 
Domain Number 3 Region: 519-586
Classification Level Classification E-value
Superfamily ACT-like 1.45e-17
Family Aspartokinase allosteric domain-like 0.0037
Further Details:      
 
Domain Number 4 Region: 261-335
Classification Level Classification E-value
Superfamily ACT-like 4.31e-16
Family Aspartokinase allosteric domain-like 0.021
Further Details:      
 
Domain Number 5 Region: 429-504
Classification Level Classification E-value
Superfamily ACT-like 0.000000000000123
Family Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113953978|ref|YP_729313.1|
Sequence length 605
Comment aspartate kinase [Synechococcus sp. CC9311]
Sequence
MALLVQKFGGTSVGSVERLQTVARRIADCKEDGNDLVIVVSAMGHTTDELTAKAKAISSD
PPQREMDMLLSTGEQVSIALLSMALHELGVPAVSMTGAQVGIVTESAHGRARILDVRTDR
LRARLAEGQVVVVAGFQGTSLSSGGTAEITTLGRGGSDTSAVALAAALGADACEIFTDVP
GVLTTDPRKVANAQLMPQVSCDEMLELASLGAAVLHPRAVEIARNYGVKMVVRSSWSDAP
GTTLTSRNAKPIGREGLELGRPVDGVELLEDQAVLALSHVPDQPGVAARLFESLSAGGVN
VDLIIQATHEGSSNDITFTVAETDLEQARSICTTLVDSLGGILSSDGGMSKLSIRGAGIM
GRPGIAAGLFDTLSREGINLRLIATSEVKVSCVVEASMGSKALQAAQQAFELSTQQQHIN
PPASGEGEPEVRGVALDRDQAQLSVRHVPDRPGMAGSLCSALADAGISLDAIVQSERQHG
DGSRDISFIVKREDRAASDQALAPLLAQWPGAVLEDGPAIARVSAIGAGMPATAGTAGRM
FRFLAEADVNIELIATSEIRTSCVVAESDGIKALEAVHAGFQLGGSESHQAQGTESPLEL
EAFKP
Download sequence
Identical sequences Q0IE09
gi|113953978|ref|YP_729313.1| 64471.sync_0075 WP_011618064.1.57161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]