SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113955213|ref|YP_730218.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113955213|ref|YP_730218.1|
Domain Number 1 Region: 211-366
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.23e-41
Family Histidine kinase 0.00075
Further Details:      
 
Domain Number 2 Region: 4-102
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.03e-28
Family KaiB-like 0.0022
Further Details:      
 
Domain Number 3 Region: 131-195
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000011
Family Homodimeric domain of signal transducing histidine kinase 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113955213|ref|YP_730218.1|
Sequence length 383
Comment adaptive-response sensory kinase [Synechococcus sp. CC9311]
Sequence
MDGIDRNPRQKLSLLLVAGRHHLSSRDLRELVEFLQNEDCGFDVSLQISDPTQQPELLEL
HRLVVTPSLVKLQPQPKQVFAGSSIFQQLRGWLPRWQQDEVVSGLGLSLKPTELDGSRTQ
RELQLEDQLLVLRQENETLIDRLQAQERLLRMVAHELRTPLTAATLAVQSQELGQIDIHR
FRDVLKRRLEEIALLSKDLLEVGSTRWEALFNPQRLDLTSVAAEAILELEKLWLGRDVTI
HTDIPADLPKVFADQRRMRQVLLNLLENALKYTPNGGLISLTMLHRTSQWVQVSISDSGP
GIPEEEQQRIFLDRVRLPQTSAGASGFGVGLSVCRRIVEVHGGRIWVISEPEKGACFTFN
VPIWQGQGQEKENVVLTEGQAEP
Download sequence
Identical sequences Q0IBF4
WP_011618940.1.57161 64471.sync_1006 gi|113955213|ref|YP_730218.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]