SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148378658|ref|YP_001253199.1| from Clostridium botulinum A str. ATCC 3502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148378658|ref|YP_001253199.1|
Domain Number 1 Region: 10-282
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 1.22e-44
Family ROO N-terminal domain-like 0.000035
Further Details:      
 
Domain Number 2 Region: 248-398
Classification Level Classification E-value
Superfamily Flavoproteins 2.74e-30
Family Flavodoxin-related 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148378658|ref|YP_001253199.1|
Sequence length 410
Comment metallo-beta-lactamase [Clostridium botulinum A str. ATCC 3502]
Sequence
MMKNVKIKEKIYLVGKIDDRDVPFHRLTLTKGTTYNSYLLLTEKPTIIDTVDISFGREYI
QSLKNLINLEKIQYIVINHTEPDHSGALGSLAYNAKNATIVCTQKAVDQLKAMYKLHNRT
FLVVKDGDTLDIGGKTLEFMETPYLHTEETMITFAKEDKILFPCDIFSTHIANYEYFNDK
AKEDILEDFKTYYSLIMHPHRRYVQNMIKKIRSLDIEIIAPSHGFILRENAKKFIDIYDE
MSKNTNVDKKVLILYSTMTNNTKKISELIKEHFEKDNINTKLIDVNKASDEDILKNVKTS
DAVLVGTSTKYGDMIGRLEEVLKSLKHMDLENKIAAAFGSYGWSGEGIEVVQDYLKETNM
KVLSTSYIIKSTGMIDVRFPIRIKFSPEENDKEEIKKATIFIADLLLNSI
Download sequence
Identical sequences A0A175M1P0 A0A2I4N3J4 A5HZK1
WP_011948382.1.10598 WP_011948382.1.25111 WP_011948382.1.28409 WP_011948382.1.49536 WP_011948382.1.49637 WP_011948382.1.63111 WP_011948382.1.65258 WP_011948382.1.65765 WP_011948382.1.74799 WP_011948382.1.92266 YP_001253199.1.75347 YP_001386590.1.17653 gi|153931136|ref|YP_001383041.1| 413999.CBO0658 441770.CLB_0696 441771.CLC_0711 gi|153937456|ref|YP_001386590.1| gi|148378658|ref|YP_001253199.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]