SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148378972|ref|YP_001253513.1| from Clostridium botulinum A str. ATCC 3502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148378972|ref|YP_001253513.1|
Domain Number 1 Region: 11-190
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.89e-42
Family Beta-D-xylosidase C-terminal domain-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148378972|ref|YP_001253513.1|
Sequence length 197
Comment hypothetical protein CBO0982 [Clostridium botulinum A str. ATCC 3502]
Sequence
MFRFNTKEGKWFFQPKNYLIEEDKVEIITEPNTDFWQRTYYGFRNDNAHVLYVTTDEKYF
SFTVKTDFNSTALFDQCGLAIYQNSENWAKACIEFHDNNTSWLGSVVTNHGYSDWATMDI
GSSVKSMWYRLSRRGSDYCFENSFDGINFKQMRIFHLFEGAKEINFGLLACSPSKNSFKA
TFTEMKITDCLWEEHKA
Download sequence
Identical sequences A0A0M0A3A3 A5I0H3
gi|153934582|ref|YP_001386903.1| gi|153933364|ref|YP_001383355.1| gi|148378972|ref|YP_001253513.1| WP_011948663.1.10598 WP_011948663.1.25111 WP_011948663.1.27088 WP_011948663.1.28409 WP_011948663.1.34822 WP_011948663.1.46754 WP_011948663.1.63111 WP_011948663.1.63218 WP_011948663.1.65258 WP_011948663.1.73124 WP_011948663.1.75721 WP_011948663.1.92266 YP_001253513.1.75347 YP_001386903.1.17653 413999.CBO0982 441770.CLB_1021 441771.CLC_1035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]