SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148379116|ref|YP_001253657.1| from Clostridium botulinum A str. ATCC 3502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148379116|ref|YP_001253657.1|
Domain Number 1 Region: 9-282
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 5.96e-56
Family ROO N-terminal domain-like 0.000000738
Further Details:      
 
Domain Number 2 Region: 250-394
Classification Level Classification E-value
Superfamily Flavoproteins 2.62e-35
Family Flavodoxin-related 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148379116|ref|YP_001253657.1|
Sequence length 396
Comment metallo-beta-lactamase/flavodoxin domain-containing protein [Clostridium botulinum A str. ATCC 3502]
Sequence
MAFKINDIVTWVGKIDWELRSFHGKEYSTYKGSSYNSYLIKDEKNVLIDTVWQPFAKEFV
SNLKKEIDLDKIDYIIVNHSESDHSGALPELMKEIPSTPIYCTKNGAKLLKAHYHEDWNF
VEVKTGDTLEIGENKLIFVEARMLHWPDSMFTYLSGKNMLFSNDAFGQHYASELMYNDKV
DSGELLQEAIKYYANILTPYSPLVIKKIEEILSFNLAVDMICPSHGIIWRENPLQIVDKY
MEWAKNYRENQATIIYDTMWNSTRRMAETIAEGIKKINKDVAIKIFNSSKNDKNDIITEV
FKSKVILVGSSTINRGMLSSTALILEMIKGLGFKEKKAAAFGSYGWGGESVKLITEELSK
AGFEIMNDGIREMWNPDDEALDRCRSFGENIGKSIK
Download sequence
Identical sequences A5I0X0
gi|148379116|ref|YP_001253657.1| YP_001253657.1.75347 413999.CBO1129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]