SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148380774|ref|YP_001255315.1| from Clostridium botulinum A str. ATCC 3502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148380774|ref|YP_001255315.1|
Domain Number 1 Region: 235-762
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 2.69e-163
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.000000497
Further Details:      
 
Domain Number 2 Region: 8-234
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 1.44e-63
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.0000395
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148380774|ref|YP_001255315.1|
Sequence length 763
Comment ribonucleotide-diphosphate reductase subunit alpha [Clostridium botulinum A str. ATCC 3502]
Sequence
MNIKIKKRDGQYEPLQVEKTKKMVKLACEGIEGCDPLELELDSRIQFRDGMTTKEIQRTL
IQTAIEKVIQNSKDNNGNNIKKTNANWQYVAARLLCFDLYKEAKISRHYNSFGYGDYYQL
VKKLVKIKLYGEYLIQNYSDEEIKELAKYIVPERDELFNYEGLKLLNDRYLIKGNNGEIL
ELPQERFMTIAMHLAIPEGDKKVFYAKKFYDLLSELKVTVATPTLGNAGTPFYQLSSCFI
SVVGDNLWSIYDVNQKFAQVSKHGGALGIYTGKIRALNSEIRGHKNASGGVVPWIRLYND
TAVAVDQLGKRKGGAAITLDIWHKDIFDFLDLKTNNGDDRRKAHDIFPSVSIPDLFMKRL
EKRESWSLFDPYIVEKIMGYKLEDYFDDEDRKEFTNKYLECERNTNIPRDTVPTLDIMKK
LMKSAVETGTPFIFFRDTVNKANPNKHKGMIYSSNLCHEIAQNMSESRLLEEEIIDGNGY
SEIVQRVKAGDMVTCNLNSINLSKVKKEEFNECIPFQIRMLDNVISLNKLPVKEAKVTSD
KYRAIGLGTSGYHHFLANNKIRWESDEHIKVADEIYEEIAYIAIKSSMELAKEKGSYPAF
KDSEWETGKYFERRGYNSERWKKLQSNIKKYGMRNGYITAIAPTGSTSNIANTTAGIDPV
FKKFFMEEKKGSFTPKTAPDLNEENFWYYKEAHTIDQQWSIKACAVRQKHIDQAQSFNLY
ITPEIKAKEILNMYIESWKQGVKTIYYVRNKSLEMDECTSCSS
Download sequence
Identical sequences A0A0M1L1K0 A5I5Q0
WP_012047928.1.10598 WP_012047928.1.25111 WP_012047928.1.27088 WP_012047928.1.28409 WP_012047928.1.34822 WP_012047928.1.46754 WP_012047928.1.63111 WP_012047928.1.63218 WP_012047928.1.65258 WP_012047928.1.75721 WP_012047928.1.92266 YP_001255315.1.75347 gi|153930834|ref|YP_001385058.1| 413999.CBO2814 441770.CLB_2757 gi|148380774|ref|YP_001255315.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]