SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148380800|ref|YP_001255341.1| from Clostridium botulinum A str. ATCC 3502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148380800|ref|YP_001255341.1|
Domain Number 1 Region: 5-291
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 5.88e-47
Family ROO N-terminal domain-like 0.0000313
Further Details:      
 
Domain Number 2 Region: 252-398
Classification Level Classification E-value
Superfamily Flavoproteins 2e-23
Family Flavodoxin-related 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148380800|ref|YP_001255341.1|
Sequence length 399
Comment metallo-beta-lactamase/flavodoxin [Clostridium botulinum A str. ATCC 3502]
Sequence
MYCVRNITEDLYWVGGNDRRLALFENIHPIEKGVSYNSYLLLDEKTVLFDTVDWSICRQF
LENIKGVLGDRNLDYMVINHMEPDHAASIDEIILRYPDVKIICTEKASMFMHQFDFNVQD
RVIKVKEGDTASFGKHKVAFMFAPMVHWPEVMVTYDTTNGMLFAADAFGTFGALDGKMFN
DEVNFDRDWIDEARRYYTNIVGKYGAQVQALLKKAKDLDIKTICPLHGPVWRSDLGYFLD
KYDKWSRYEPEEKGVMIVYGTMYGNTEAAANNLATELVKKGITNVAMYDVSKTHVSYLIS
ETFKYSHIVLACVTYNLNIYPPMLAYIMDMKALNVQNRTFALIENGSWAPQSGKLMRKHL
SDMKEITILDNDISVNSSVKEQDKDSIDEVVDSIIQSMK
Download sequence
Identical sequences A0A0M0A5A5 A5I5S7
413999.CBO2842 441770.CLB_2785 441771.CLC_2718 gi|153932692|ref|YP_001385085.1| gi|148380800|ref|YP_001255341.1| gi|153937669|ref|YP_001388554.1| WP_011987112.1.21778 WP_011987112.1.27088 WP_011987112.1.34822 WP_011987112.1.46754 WP_011987112.1.57120 WP_011987112.1.63111 WP_011987112.1.63218 WP_011987112.1.75721 YP_001255341.1.75347 YP_001388554.1.17653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]