SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|134045825|ref|YP_001097311.1| from Methanococcus maripaludis C5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134045825|ref|YP_001097311.1|
Domain Number 1 Region: 3-236
Classification Level Classification E-value
Superfamily Aquaporin-like 6.15e-62
Family Aquaporin-like 0.0000241
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|134045825|ref|YP_001097311.1|
Sequence length 239
Comment MIP family channel protein [Methanococcus maripaludis C5]
Sequence
MSLLKRMIAEGLGTGILVFFGPGAAAMTLMIANSTGSAGIGLLGGLGDWFAIGFAFALAI
AAVIYSMGRVSGAHINPAVTVGLWAVKKFPTKDVIPYIIAQLIGAAIGSILFFTCIGLDS
VTIGGLGATAPFAGISYFQAILAEFIGTFLLMFVILGVAVDKRAPDGFAGLVIGLTVGAI
ITTTGNIAGASLNPARTFGPYLIDSIYGLNLWYYFPIYIIGPIIGAIVAAFTYEYLNRE
Download sequence
Identical sequences A4FY12
402880.MmarC5_0786 WP_011868550.1.72418 gi|134045825|ref|YP_001097311.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]