SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|134045946|ref|YP_001097432.1| from Methanococcus maripaludis C5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134045946|ref|YP_001097432.1|
Domain Number 1 Region: 435-517
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000275
Family Anti-sigma factor antagonist SpoIIaa 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|134045946|ref|YP_001097432.1|
Sequence length 539
Comment sulfate transporter [Methanococcus maripaludis C5]
Sequence
MNEKINTNETKDLKNKIVELVIPKNGSVKNDVLSGLTVALALVPEAIAFSFILGIDPTIG
LYAAFIMGIVTALIGGRPGMISGATGAVAVIFAPLVISKVQTSGMESALGHLFIAVLFMG
IIQVFFGISKVGKFVRLIPHPVMLGFVNGLAIIIFLSQLGQFYGADGNLLPWPILSVMLI
LIVITMIIAIYLPKITRAVPATLVAIITVTIISYFLNNAGYTVLTVLDFIKSIEPLKTTL
AVSVPSFALPNVPLNWDTVKTVLPYSFLAACVGLIESLMTLRLIDELTETRGRSNRECIG
QGIANILNGFFGGMGGCAMIGQSMINIRGGGRGRLSGISAAILLLIFIVWGAPIIEMIPL
AALVGVMFIVVIGTFEWSSFRILKKIPSSDAAIIAVVSIMTVVFNLATAVFLGIILAALV
FAWNRGKDIWASTKSMKNKKVYMLHGPLFFASTSKFKSLFDYQNDPIDVVIDFNKSRVYD
HSAIEAINSVAEKYTQHGKQLHLLNLSRDCDKLIKKADNIVEVSILDNLIWHVADDELE
Download sequence
Identical sequences A4FYD3
gi|134045946|ref|YP_001097432.1| GO.8808 WP_011868671.1.72418 402880.MmarC5_0911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]