SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|134046109|ref|YP_001097595.1| from Methanococcus maripaludis C5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134046109|ref|YP_001097595.1|
Domain Number 1 Region: 434-536
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000255
Family Anti-sigma factor antagonist SpoIIaa 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|134046109|ref|YP_001097595.1|
Sequence length 552
Comment sulfate transporter [Methanococcus maripaludis C5]
Sequence
MKINQNLNYENLKNDLFAGFTIAIVALPLAMAFAIASGVSPEKGLFTAIVAGFLISLLGG
SKYQIGGPTGAFVVILFGIIASYGYEGLVIATLMAGLILIGMGLLKLGNIIKFIPYPVTM
GFTSGIALIIFSTQIKDFFGLSIGSIPATFLDQWIVYLTHIQLLNPYALFISILTLIILT
NSKKVFSKIPSPIIAIIAGIFLVYFFNLPVETIESKFGQIPNTIPFPNLPELNLQKMELL
FPSALSIAFLGAIESLMCAVVADGMTGYKHNSNKELVGQGIANIGSVLFGGIPATGALAR
TATNIKAGATSRLSGIIHVIMLFLFMLLLSPLILKIPLATLSAILVVVAWNMAEVKHFKS
ILFKSPKRDRIVLLVTFLLTVFVNLNTAIQIGMLLAVIVFMQRLIEVSEISNLKTIPQEK
DPYSITLKDVPPCIEVYEVNGPFFFGIADKFKSTLNVVAKRKPSAIILRMRNVPIIDATG
IKNLEEFIESSKKQDISLIISGADYNLRKKFEKYGLTNMIGKENICEDIDLALARARELI
KIKHPETGLCPE
Download sequence
Identical sequences A4FYU6
WP_011868833.1.72418 402880.MmarC5_1078 gi|134046109|ref|YP_001097595.1| GO.8809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]