SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|134046240|ref|YP_001097725.1| from Methanococcus maripaludis C5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|134046240|ref|YP_001097725.1|
Domain Number - Region: 118-193
Classification Level Classification E-value
Superfamily Aquaporin-like 0.0262
Family Aquaporin-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|134046240|ref|YP_001097725.1|
Sequence length 200
Comment signal transduction histidine kinase LytS [Methanococcus maripaludis C5]
Sequence
MKEELRALQNDRESYKKVLYRYLIIFSIGINIIGVQLVSILNFPAFLNTVGTILAGVLMG
PFMGALVGLLTSIILGFLVDPGYFYFTFVNILVGFIAGYIFKEHPFNIKTVLGASIFISI
LTAIVGNTISYMALGGVAGDQIDKITQILIEKGFNVFLAVNITGFFANLLDKILSFLLVF
IVIVILDKKLEMPDFQIRWK
Download sequence
Identical sequences A4FZ77
gi|134046240|ref|YP_001097725.1| WP_011868964.1.72418 402880.MmarC5_1213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]