SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|134046627|ref|YP_001098112.1| from Methanococcus maripaludis C5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134046627|ref|YP_001098112.1|
Domain Number 1 Region: 5-68
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.14e-18
Family TRAM domain 0.0000679
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|134046627|ref|YP_001098112.1|
Sequence length 69
Comment deoxyribonuclease [Methanococcus maripaludis C5]
Sequence
MAFGKPAMKNVPVEAGKEYEVSIEDMGKGGDGIARIDGFVVFVPNAEKGSVIKVKVTAVK
EKFAFAERV
Download sequence
Identical sequences A4G0B4 A6VI65 A9A8L4
gi|159905257|ref|YP_001548919.1| 402880.MmarC5_1601 426368.MmarC7_1075 444158.MmarC6_0872 gi|150402998|ref|YP_001330292.1| WP_011869345.1.31125 WP_011869345.1.31524 WP_011869345.1.72418 gi|134046627|ref|YP_001098112.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]