SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|134046036|ref|YP_001097522.1| from Methanococcus maripaludis C5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134046036|ref|YP_001097522.1|
Domain Number 1 Region: 86-171
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.46e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00026
Further Details:      
 
Domain Number 2 Region: 6-79
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000522
Family Eukaryotic type KH-domain (KH-domain type I) 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|134046036|ref|YP_001097522.1|
Sequence length 184
Comment putative RNA-processing protein [Methanococcus maripaludis C5]
Sequence
MYENVEVVKIPKERTGILIGTHGEVRKTLESELGVELEIDSEGEVNIYSTEGQEDPLALW
KARDIVKAIGRGFNPEKALKLVSDEYAFEVIDISEYGNSDKALQRLKGRIIGSSGKSRRY
IEELTSTHISVYGKTVSIIGEIETAKIAKDAIEMLLRGTSHSKMYKFLERHRQDVKRSEL
RLWK
Download sequence
Identical sequences A4FYM3
gi|134046036|ref|YP_001097522.1| WP_011868760.1.72418 402880.MmarC5_1001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]