SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|119897555|ref|YP_932768.1| from Azoarcus sp. BH72

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119897555|ref|YP_932768.1|
Domain Number 1 Region: 4-113
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 8.11e-20
Family Toll/Interleukin receptor TIR domain 0.0046
Further Details:      
 
Domain Number 2 Region: 244-320
Classification Level Classification E-value
Superfamily LCCL domain 4.32e-18
Family LCCL domain 0.0013
Further Details:      
 
Domain Number 3 Region: 348-422
Classification Level Classification E-value
Superfamily LCCL domain 2.22e-17
Family LCCL domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119897555|ref|YP_932768.1|
Sequence length 423
Comment putative transmembrane sensor protein [Azoarcus sp. BH72]
Sequence
MSRKAFISHASEDARIATALCAFLEGAGVPCWIAPRDVTPGREYAEEILDGIEGCAVFVL
LLSAQANRSPFVRRELERAASKDKPLFLVRIEEVQPDRSLELFVSSEHWIDAWAPPLETH
WARLANAIRGERAVAPPAQAARRPSAATKMVGLGAGLGVLMSLLAVGVWSWLTPAHEEAG
GSTSAAQPSATLVTPAGPLVATATGPAAPPAGSAAPEASAAAADDGAEPCPGYYAINPQL
PSPYACTCGTVVSSQGSVWGSDIYTADSALCKAAVHAGVIPRSGGRVVVERVDGRELYVG
TSRNGIGTSDYGPHHPAIHFVGSAQPAQPEPCPTFLAINPNLATPHVCRCAAGDTLQGSV
WGSDPYTADSRLCRAAVHAGRIGTEGGTVTVVYADGRAMYSGSERNGVRSSDYGAYPLSI
RFQ
Download sequence
Identical sequences A1K4X6
62928.azo1264 WP_011764997.1.91620 gi|119897555|ref|YP_932768.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]