SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|120602033|ref|YP_966433.1| from Desulfovibrio vulgaris subsp. vulgaris DP4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|120602033|ref|YP_966433.1|
Domain Number 1 Region: 16-195
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 7.9e-38
Family RNA methyltransferase FtsJ 0.0000881
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|120602033|ref|YP_966433.1|
Sequence length 204
Comment ribosomal RNA methyltransferase RrmJ/FtsJ [Desulfovibrio vulgaris DP4]
Sequence
MKKYRDHYFLKAKQENYPARSVYKLKEIDNRFKIFRQGMKVLDLGAAPGSWSLGAAEKVG
PRGRVLACDLQETDTVFPDNVTFMQENVFERSEAFENLLDEIAPFDVVISDMAPRTTGTR
FTDQARSLELCLEALAVADRCLIKGGSFVVKIFMGPDVQELVQAMRQRFSAVKSFKPKSS
RAESKETFYVCLGYRGVETSDTDK
Download sequence
Identical sequences A0A0E0T3Z8 A1VC40 Q729T9
gi|120602033|ref|YP_966433.1| WP_010939535.1.14085 WP_010939535.1.63145 YP_011473.1.77684 gi|387153949|ref|YP_005702885.1| gi|46580665|ref|YP_011473.1| 391774.Dvul_0985 882.DVU2260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]