SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148269855|ref|YP_001244315.1| from Thermotoga petrophila RKU-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148269855|ref|YP_001244315.1|
Domain Number 1 Region: 285-548
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.05e-70
Family Tandem AAA-ATPase domain 0.000000000246
Further Details:      
 
Domain Number 2 Region: 108-280
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.91e-55
Family RecG "wedge" domain 0.0000000266
Further Details:      
 
Domain Number 3 Region: 487-696
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.85e-42
Family Tandem AAA-ATPase domain 0.0000000545
Further Details:      
 
Domain Number 4 Region: 6-104
Classification Level Classification E-value
Superfamily RecG, N-terminal domain 1.83e-35
Family RecG, N-terminal domain 0.00000244
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148269855|ref|YP_001244315.1|
Sequence length 779
Comment ATP-dependent DNA helicase RecG [Thermotoga petrophila RKU-1]
Sequence
MCSRYFTSSLSLWGEALPILLEEFLNEVEKMLKNQVNTRRIYQLLQELDDPLLDNKDLEE
KLQAFLDYAKEIPNLPEVRKRYRIQKSLEMIEKLRSWFLIDYLECSGEEVDLSTDIQYAK
GVGPNRKKKLKKLGIETLRDLLEFFPRDYEDRRKIFKLNDLLPGEKVTTQGKIVSVETKR
FQNMNILTAVLSDGLVHVLLKWFNQEYLQTYLKQLTGKEVFVTGTVKSNAYTGQYEIHNA
EVTPKEGEYARRILPIYRLTSGISQKQMRKIFEENIPSLCCSLKETLPERILEKRKLLGV
KDAYYGMHFPKTFYHLEKARERLAYEELFVLQLAFQKIRKEREKHGGIPKKIEGKLAEEF
IKSLPFKLTNSQKRAHQEIRNDMISEKPMNRLLQGDVGSGKTVVAQLAILDNYEAGFQTA
FMVPTSILAIQHYRRTIESFSKFNIHVALLIGATTPSEKEKIKSGLRNGQIDVVIGTHAL
IQEDVHFKNLGLVIIDEQHRFGVKQREALMNKGKMVDTLVMSATPIPRSMALAFYGDLDV
TVIDEMPPGRKEVQTMLVPMDRVNEIYEFVRQEVMKGGQAFIVYPLIEESDKLNVKSAVE
MYEYLSKEVFPEFKLGLMHGRLSQEEKDRVMLEFAEGRYDILVSTMVIEVGIDVPRANVM
VIENPERFGLAQLHQLRGRVGRGGQEAYCFLVVGDVGEEAMERLRFFTLNTDGFKIAEYD
LKTRGPGEFFGVKQHGLSGFKVADLYRDLKLLEWAREDVQEIDVEGIELPEEIKLIEVG
Download sequence
Identical sequences A5IKL6
390874.Tpet_0719 gi|148269855|ref|YP_001244315.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]